PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000126141
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 747aa    MW: 83138.9 Da    PI: 4.574
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000126141genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM31.26.1e-102165348
            NAM  3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                   + +rFhPt++e+  ++L+kk++++k ++ ++++ +d++k+ePwdLp
  MDP0000126141 21 AAIRFHPTEKEMA-DFLRKKMKSHKSQACHFLPVIDVCKFEPWDLP 65
                   568********99.9**********999999**************9 PP

2NAM46.21.5e-1412920554127
            NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfy.....kgrapkgektdWvmheyr 127
                    + k wy Fs  d ky ++ r nr+t++g+Wk tgk +++    +  +  k+tL+f      +g a+k+++t W++hey 
  MDP0000126141 129 QAKAWYSFSWCDYKYINSLRCNRVTEHGFWKITGKPRDISL--KYFTCKKRTLTFQxktfqEGGASKSVRTGWIIHEYY 205
                    5689***********************************99..55677888999998777789999************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.29E-101088IPR003441NAC domain
PROSITE profilePS5100522.99919233IPR003441NAC domain
PfamPF023652.3E-1022204IPR003441NAC domain
SuperFamilySSF1019412.88E-16127233IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 747 aa     Download sequence    Send to blast
MENSSTTTRT TTAQSXPDMV AAIRFHPTEK EMADFLRKKM KSHKSQACHF LPVIDVCKFE  60
PWDLPGNPLF YLTFSLKPRL GPRLASRIRL DGGVTRLNED IDVEDQLVMG ETCPFQSFHE  120
RMFPDSVFQA KAWYSFSWCD YKYINSLRCN RVTEHGFWKI TGKPRDISLK YFTCKKRTLT  180
FQXKTFQEGG ASKSVRTGWI IHEYYCTKPK QGSSPRQERD LKRDYVICLL KCKPVDSKSD  240
KKKPEGTSVC DDLADPGNSG YIASSPGDDH TASAAAMNHM TPDTEEVLAY KELEDDLLGS  300
GNHDHGEPGG GVSSDSIDQA LLDPGSGTGG CIPYNFDNQA AAMNHMVPNX EEILADKQPE  360
RAVLGSXNHD DGEPGIGISS DFIYQAVDDM TLEFYDQLEK DLDSPLSPPG PPQPHQLRNF  420
PDVHCGEFSN WPSTIGDNDS YDXIKNNIAT NYDNXPVINI AYNSQNLAPN ERISEAYSQP  480
EENXGSPFQR FDQLQNYTLQ SCAPAGEYXN SLFPXPQSPQ PHQPPQLGNA PDVCSDESID  540
PGTGGXMTYN TDNQAAAMNH VISNTEEILT YKQLELAVLG NXNHXDGEPX XGISSXFIXQ  600
AXXDMXLEAY SQPEENRGSP FQLFHQLXNY PLXSPILFSE LGELLLANTC IGHNESQSFN  660
MEPATLFPQN NCNIHQHPFL FTPXEMLQDG SECRAVSRNK DCEAAASALY CCLLIPSEAG  720
MECAANWKGS FNFPEASPLS DKSNRPG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008347197.10.0PREDICTED: uncharacterized protein LOC103410235
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1887626
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39820.12e-16NAC domain containing protein 94